{"product_id":"proteintech-28511-1-ap","title":"Proteintech, 28511-1-AP, Piezo1 (extracellular domain) Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Piezo1 (extracellular domain) (28511-1-AP) by Proteintech is a Polyclonal antibody targeting Piezo1 (extracellular domain) in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n28511-1-AP targets Piezo1 (extracellular domain) in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Hepa1-6 cells,  HepG2 cells,  hTERT-RPE1 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMechanotransduction, the conversion of mechanical force into biological signals, is a fundamental physiologic process of mammalian cells which influences many critical processes including embryonic development, tactile, pain, and auditory sensation, regulation of vascular tone, flow sensing in the kidney, and muscle and tendon stretch. FAM38A, also known as PIEZO1, has recently been identified as a mechanotransduction protein that gets  involved in mechanosensation and stretch-activated cation channel activation. Fam38A also plays a key role in epithelial cell adhesion by maintaining integrin activation through R-Ras recruitment to the ER. Mutations in gene encoding PIEZO1 are associated with hereditary xerocytosis. Piezo1 also regulates extrusion to maintain homeostatic epithelial cell numbers. This antibody was raised against the extracellular domain of human Piezo1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29858 Product name: Recombinant human FAM38A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 108-294 aa of BC008073 Sequence: YEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDK Predict reactive species\nFull Name: family with sequence similarity 38, member A\nCalculated Molecular Weight: 286 kDa\nObserved Molecular Weight: 280-300 kDa\nGenBank Accession Number: BC008073\nGene Symbol: Piezo1\/FAM38A\nGene ID (NCBI): 9780\nRRID: AB_2881161\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92508\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868874428585,"sku":"28511-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28511-1-ap","provider":"Iright","version":"1.0","type":"link"}