{"product_id":"proteintech-28514-1-ap","title":"Proteintech, 28514-1-AP, APOOL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe APOOL (28514-1-AP) by Proteintech is a Polyclonal antibody targeting APOOL in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples\n28514-1-AP targets APOOL in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, LNCaP cells,  HepG2 cells,  mouse heart tissue,  rat heart tissue\nPositive IHC detected in: human kidney tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAPOOL, the component of the MICOS complex, is a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Specifically binds to cardiolipin (in vitro) but not to the precursor lipid phosphatidylglycerol. Plays a crucial role in crista junction formation and mitochondrial function (PubMed:23704930), (PubMed:25764979). Its molecular weight is about 30 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29392 Product name: Recombinant human APOOL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 127-268 aa of BC107096 Sequence: VSARKGSKFKKITYPLGLATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPEDIDMYSTRS Predict reactive species\nFull Name: apolipoprotein O-like\nCalculated Molecular Weight: 268 aa, 29 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC107096\nGene Symbol: APOOL\nGene ID (NCBI): 139322\nRRID: AB_3086061\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UXV4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869637660841,"sku":"28514-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28514-1-ap","provider":"Iright","version":"1.0","type":"link"}