{"product_id":"proteintech-28519-1-ap","title":"Proteintech, 28519-1-AP, FUNDC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FUNDC1 (28519-1-AP) by Proteintech is a Polyclonal antibody targeting FUNDC1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n28519-1-AP targets FUNDC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, A-673 cells,  mouse brain tissue,  mouse liver tissue,  rat brain tissue,  rat liver tissue,  C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFUNDC1 is a novel mitochondrial-associated membrane (MAM) protein, enriched at the MAM by interacting with the ER resident protein CANX (calnexin) under hypoxia. As mitophagy proceeds, it dissociates from CANX and preferably recruits DNM1L\/DRP1 to drive mitochondrial fission in response to hypoxic stress.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29358 Product name: Recombinant human FUNDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 96-155 aa of BC042813 Sequence: QIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS Predict reactive species\nFull Name: FUN14 domain containing 1\nCalculated Molecular Weight: 155 aa, 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC042813\nGene Symbol: FUNDC1\nGene ID (NCBI): 139341\nRRID: AB_2935469\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IVP5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868924694697,"sku":"28519-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28519-1-ap","provider":"Iright","version":"1.0","type":"link"}