{"product_id":"proteintech-28532-1-ap","title":"Proteintech, 28532-1-AP, PGC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGC (28532-1-AP) by Proteintech is a Polyclonal antibody targeting PGC in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n28532-1-AP targets PGC in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse stomach tissue, rat stomach tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPepsinogen II also known as progastricsin or PGC(pepsinogen C), is an aspartic protease expressed primarily in gastric chief cells and is a novel marker of type 2 cells with advantages over many of the current markers used to identify type 2 cells in the developing lung(PMID:14578117). It is involved in proteolysis and peptidolysis. This protein has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29347 Product name: Recombinant human PGC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC073740 Sequence: MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIGTPPQNFLVLF Predict reactive species\nFull Name: progastricsin (pepsinogen C)\nCalculated Molecular Weight: 388 aa, 42 kDa\nObserved Molecular Weight: 34-42 kDa\nGenBank Accession Number: BC073740\nGene Symbol: PGC\nGene ID (NCBI): 5225\nRRID: AB_2918173\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20142\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869571174569,"sku":"28532-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28532-1-ap","provider":"Iright","version":"1.0","type":"link"}