{"product_id":"proteintech-28548-1-ap","title":"Proteintech, 28548-1-AP, ABCE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABCE1 (28548-1-AP) by Proteintech is a Polyclonal antibody targeting ABCE1 in WB, IHC, ELISA applications with reactivity to human samples\n28548-1-AP targets ABCE1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  HeLa cells,  K-562 cells,  MCF-7 cells,  NCI-H1299 cells\nPositive IHC detected in: human breast cancer tissue, human ovary tumor tissue,  human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29724 Product name: Recombinant human ABCE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 319-436 aa of BC016283 Sequence: TENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAY Predict reactive species\nFull Name: ATP-binding cassette, sub-family E (OABP), member 1\nCalculated Molecular Weight: 599 aa, 67 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC016283\nGene Symbol: ABCE1\nGene ID (NCBI): 6059\nRRID: AB_2881169\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61221\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868991770793,"sku":"28548-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28548-1-ap","provider":"Iright","version":"1.0","type":"link"}