{"product_id":"proteintech-28575-1-ap","title":"Proteintech, 28575-1-AP, TRIM59 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIM59 (28575-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM59 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n28575-1-AP targets TRIM59 in WB, IHC, IF\/ICC, CoIP, ChIP, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, rat spleen tissue\nPositive IHC detected in: human pancreas cancer tissue, human liver tissue,  human breast cancer tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRIM59 belongs to the tripartite motif (TRIM) family. It functions as E3 ubiquitin ligases or an adaptor protein,  and plays important roles in various types of human cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29560 Product name: Recombinant human TRIM59 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 128-326 aa of NM_173084 Sequence: GHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEF Predict reactive species\nFull Name: tripartite motif-containing 59\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: NM_173084\nGene Symbol: TRIM59\nGene ID (NCBI): 286827\nRRID: AB_2918177\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IWR1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869505605801,"sku":"28575-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28575-1-ap","provider":"Iright","version":"1.0","type":"link"}