{"product_id":"proteintech-28579-1-ap","title":"Proteintech, 28579-1-AP, CDA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDA (28579-1-AP) by Proteintech is a Polyclonal antibody targeting CDA in WB, FC (Intra), ELISA applications with reactivity to human samples\n28579-1-AP targets CDA in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29507 Product name: Recombinant human CDA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-146 aa of NM_001785 Sequence: LLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ Predict reactive species\nFull Name: cytidine deaminase\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: NM_001785\nGene Symbol: CDA\nGene ID (NCBI): 978\nRRID: AB_2881174\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P32320\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869523169449,"sku":"28579-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28579-1-ap","provider":"Iright","version":"1.0","type":"link"}