{"product_id":"proteintech-28580-1-ap","title":"Proteintech, 28580-1-AP, NOTCH2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NOTCH2 (28580-1-AP) by Proteintech is a Polyclonal antibody targeting NOTCH2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n28580-1-AP targets NOTCH2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-87 MG cells, HEK-293T cells\nPositive IP detected in: HEK-293 cells, U-87 MG cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNOTCH2 (Neurogenic locus notch homolog protein 2) belongs to the NOTCH family.. In kidney, previous reports demonstrated that Notch1 and Notch2 were activated in mammalian nephrogenesis (PMID: 24526233). Notch2 is expressed in many cell types of most lineages in the hematolymphoid compartment and has specific roles in differentiation and function of various immune cells. Notch2 is required for development of splenic marginal zone B cells and regulates differentiation of dendritic cells (DCs) in the spleen. Notch2 appears to play some specific roles in the intestinal immunity, given that the fate of mast cells and a subset of DCs is regulated by Notch2 in the intestine. Notch2 also has important roles in helper T cell divergence from naïve CD4 T cells and activation of cytotoxic T cells (PMID: 22695918).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29413 Product name: Recombinant human NOTCH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1697-1819 aa of NM_024408 Sequence: VIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNLSVQVSEANLIGTGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVL Predict reactive species\nFull Name: Notch homolog 2 (Drosophila)\nCalculated Molecular Weight: 265 kDa\nObserved Molecular Weight: 110 kDa, 265 kDa\nGenBank Accession Number: NM_024408\nGene Symbol: NOTCH2\nGene ID (NCBI): 4853\nRRID: AB_2881175\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q04721\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868903067817,"sku":"28580-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28580-1-ap","provider":"Iright","version":"1.0","type":"link"}