{"product_id":"proteintech-28621-1-ap","title":"Proteintech, 28621-1-AP, KLHL32 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KLHL32 (28621-1-AP) by Proteintech is a Polyclonal antibody targeting KLHL32 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n28621-1-AP targets KLHL32 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  HepG2 cells,  PC-3 cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKLHL32 (Kelch-like protein 32), also known BKLHD5, which is located in the cytoplasm. The expression level is high in the central nervous system, especially in astrocytes. In addition, it is also expressed in the motor cilia of fallopian tube. But the overall expression abundance is low. KLHL32 is mainly involved in the intracellular ubiquitination process. Ubiquitin is an important cellular regulatory mechanism, through which protein can be labeled to degrade or change its function. KLHL32 interacts with other protein through its BTB domain and Kelch repeat domain to help regulate this process. It is also a prognostic marker in glioblastoma and renal clear cell carcinoma. The molecular weight of KLHL32 is 70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29003 Product name: Recombinant human KLHL32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 169-318 aa of BC071627 Sequence: KHLSELLKSRPEEVLTLPYCLLQEVLKSDRLTSLSEEQIWQLAVRWLEHNCHYQYMDELLQYIRFGLMDVDTLHTVALSHPLVQASETATALVNEALEYHQSIYAQPVWQTRRTKPRFQSDTLYIIGGKKREVCKVKELRYFNPVDQENA Predict reactive species\nFull Name: kelch-like 32 (Drosophila)\nCalculated Molecular Weight: 470 aa, 53 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC071627\nGene Symbol: KLHL32\nGene ID (NCBI): 114792\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96NJ5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887698366633,"sku":"28621-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28621-1-ap","provider":"Iright","version":"1.0","type":"link"}