{"product_id":"proteintech-28622-1-ap","title":"Proteintech, 28622-1-AP, BCAT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BCAT1 (28622-1-AP) by Proteintech is a Polyclonal antibody targeting BCAT1 in WB, IHC, ELISA applications with reactivity to Human, rat samples\n28622-1-AP targets BCAT1 in WB, IHC, ELISA applications and shows reactivity with Human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C6 cells, Jurkat cells\nPositive IHC detected in: human liver cancer tissue, human lung cancer tissue,  human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBCAT1, also named as branched-chain amino acid trasaminase1, is a cytosolic enzyme responsible for the reversible transamination of leucine, isoleucine and valine that catalyzes the transformation of branched-chain L-amino acids (BCAA) into branched-chain a-ketoacids (BCKA), thereby providing macromolecule precursors. It has been reported that BCAT1 is associated with tumor growth and disease progression (PMID:29255149).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28998 Product name: Recombinant human BCAT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-115 aa of BC033864 Sequence: MDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLN Predict reactive species\nFull Name: branched chain aminotransferase 1, cytosolic\nCalculated Molecular Weight: 320 aa, 36 kDa\nObserved Molecular Weight: 43-48 kDa\nGenBank Accession Number: BC033864\nGene Symbol: BCAT1\nGene ID (NCBI): 586\nRRID: AB_2881183\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P54687\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869517926569,"sku":"28622-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28622-1-ap","provider":"Iright","version":"1.0","type":"link"}