{"product_id":"proteintech-28632-1-ap","title":"Proteintech, 28632-1-AP, SLC38A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC38A1 (28632-1-AP) by Proteintech is a Polyclonal antibody targeting SLC38A1 in WB, IHC, ELISA applications with reactivity to Human, mouse samples\n28632-1-AP targets SLC38A1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse brain tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:14000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC38A1 (Sodium-coupled neutral amino acid transporter 1), is also named as SNAT1, which is a symporter that cotransports short-chain neutral amino acids and sodium ions from the extraccellular to the intracellular side of the cell membrane (PMID:20599747, PMID:10891391). Inhibition of SLC38A1 reduced tumor growth, cellular migration, invasion, and induced senescence in melanoma cells (PMID:35565278). SLC38A1 was identified as a positive regulator of mTORC1 in neurons, which promoted ischemic brain damage by mTOR-autophagy system (PMID:31552299). SLC38A1 is mainly expressed in brain and placenta.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30088 Product name: Recombinant human SLC38A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-74 aa of BC010620 Sequence: MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGTTSLG Predict reactive species\nFull Name: solute carrier family 38, member 1\nCalculated Molecular Weight: 487 aa, 54 kDa\nObserved Molecular Weight: 54 kDa, 60-70 kDa\nGenBank Accession Number: BC010620\nGene Symbol: SLC38A1\nGene ID (NCBI): 81539\nRRID: AB_3086073\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H2H9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868989083817,"sku":"28632-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28632-1-ap","provider":"Iright","version":"1.0","type":"link"}