{"product_id":"proteintech-28671-1-ap","title":"Proteintech, 28671-1-AP, RFC5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RFC5 (28671-1-AP) by Proteintech is a Polyclonal antibody targeting RFC5 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n28671-1-AP targets RFC5 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, U-251 cells,  HEK-293T cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nReplication factor C subunit 5 (RFC5), also known as activator 1, can recruit proliferating cell nuclear antigen(PCNA) onto the DNA polymerase S-phase checkpoint complex. In eukaryotes, RFC5 is involved in repairing mismatches, DNA double helix damage, nucleotide excision, and regulating the cell cycle(PMID: 30210909). RFC5 is significantly upregulated in cancer tissues or cells, and its expression is elevated with the cancer progression(PMID: 30214556).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29236 Product name: Recombinant human RFC5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 219-341 aa of BC001866 Sequence: ILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA Predict reactive species\nFull Name: replication factor C (activator 1) 5, 36.5kDa\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC001866\nGene Symbol: RFC5\nGene ID (NCBI): 5985\nRRID: AB_2918189\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P40937\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887783268521,"sku":"28671-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28671-1-ap","provider":"Iright","version":"1.0","type":"link"}