{"product_id":"proteintech-28677-1-ap","title":"Proteintech, 28677-1-AP, SIRT6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SIRT6 (28677-1-AP) by Proteintech is a Polyclonal antibody targeting SIRT6 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n28677-1-AP targets SIRT6 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Jurkat cells,  PC-3 cells\nPositive IHC detected in: human placenta tissue, mouse colon tissue,  mouse liver tissue,  rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe SIRT6 gene is located at chromosome 19p13.3 and contains 8 exons. The encoded protein has a total length of 355 amino acids. SIRT6 protein is a member of the Sirtuins, which is a class of NAD+-dependent protein deacetylases involved in stress resistance and metabolic homeostasis. SIRT6 also plays roles in various tumors as both an oncogene and tumor suppressor gene. A previous study in osteosarcoma reported that SIRT6 regulates the migration and invasion of tumors through the ERK1\/2\/MMP9 pathway. (PMID: 30675128)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29163 Product name: Recombinant human SIRT6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-328 aa of BC028220 Sequence: ATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS Predict reactive species\nFull Name: sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae)\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: BC028220\nGene Symbol: SIRT6\nGene ID (NCBI): 51548\nRRID: AB_3669666\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N6T7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887802503337,"sku":"28677-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28677-1-ap","provider":"Iright","version":"1.0","type":"link"}