{"product_id":"proteintech-28683-1-ap","title":"Proteintech, 28683-1-AP, SGLT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SGLT2 (28683-1-AP) by Proteintech is a Polyclonal antibody targeting SGLT2 in WB, IHC, IF-P, ELISA applications with reactivity to Human, mouse, rat samples\n28683-1-AP targets SGLT2 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat kidney tissue\nPositive IHC detected in: human kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse kidney tissue, rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSodium-glucose cotransporter 2 (SGLT2), encoded by SLC5A2, utilizes the electrochemical sodium gradient to transport glucose against the cell's internal concentration gradient. Mainly expressed on brush border membrane (BBM) of epithelial cells in the early segment of the proximal tubule, SGLT2 mediates most of the glucose reabsorption by the kidney overall. Inhibition of SGLT2 could improve glucose homeostasis of diabetic patients, which has been considered as a novel strategy for diabetes treatment.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30120 Product name: Recombinant human SLC5A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 222-285 aa of BC131542 Sequence: EVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTI Predict reactive species\nFull Name: solute carrier family 5 (sodium\/glucose cotransporter), member 2\nCalculated Molecular Weight: 672 aa, 73 kDa\nObserved Molecular Weight: 73 kDa\nGenBank Accession Number: BC131542\nGene Symbol: SGLT2\nGene ID (NCBI): 6524\nRRID: AB_2918190\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31639\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869597454505,"sku":"28683-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28683-1-ap","provider":"Iright","version":"1.0","type":"link"}