{"product_id":"proteintech-28702-1-ap","title":"Proteintech, 28702-1-AP, METAP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe METAP1 (28702-1-AP) by Proteintech is a Polyclonal antibody targeting METAP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n28702-1-AP targets METAP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, A375 cells,  HCT-116 cells,  HUVEC cells,  HeLa cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMETAP1 (methionyl aminopeptidase 1), also known as MAP1A or MetAP1A, is expected to be located in cytosol and widely expressed in esophagus and testis. The calculated molecular weight of METAP1 is 43 kDa. METAP1 is expected to have aminopeptidase activity and metallo-exopeptidase activity. It is also involved in platelet aggregation. At the same time, HsMetAP1 participates in co-translation to remove N- terminal methionine from newborn protein. Studies have shown that when HsMetAP1 is knocked down by gene-specific siRNA, cells show slow progress in G(2)\/M phase, which is similar to cells treated with MetAP1 inhibitors. Importantly, MetAP1 inhibitors can induce apoptosis of leukemia cell lines, which may be the result of their interference with G(2)\/M checkpoint. Therefore, it is necessary for normal cell cycle, especially in G(2)\/M phase of cell cycle, and it can be used as a promising target for discovering and developing new anticancer drugs (PMID: 17114291).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29828 Product name: Recombinant human METAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-167 aa of NM_015143 Sequence: MAAVETRVCETDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSWATHKLLHKKAKDEKAKREVSSWTVEGDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEID Predict reactive species\nFull Name: methionyl aminopeptidase 1\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 40-43 kDa\nGenBank Accession Number: NM_015143\nGene Symbol: METAP1\nGene ID (NCBI): 23173\nRRID: AB_3086080\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P53582\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869709291689,"sku":"28702-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28702-1-ap","provider":"Iright","version":"1.0","type":"link"}