{"product_id":"proteintech-28722-1-ap","title":"Proteintech, 28722-1-AP, IFN-gamma Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFN-gamma (28722-1-AP) by Proteintech is a Polyclonal antibody targeting IFN-gamma in WB, ELISA applications with reactivity to human samples\n28722-1-AP targets IFN-gamma in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PMA, Ionomycin and Brefeldin A treated NK-92 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterferon gamma (IFNG) is a soluble cytokine that is the only member of the type II class of interferons. It is secreted by Th1 cells, cytotoxic T cells and NK cells. The cytokine is associated with antiviral, immunoregulatory and anti-tumor properties and is a potent activator of macrophages. It plays crucial roles in pathogen clearance. Aberrant IFNG expression is associated with a number of autoinflammatory and autoimmune diseases. It has been identified in many studies as a biomarker for pleural tuberculosis (TB). Mutations in this gene are associated with aplastic anemia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30371 Product name: Recombinant human IFNG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 85-161 aa of BC070256 Sequence: DDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG Predict reactive species\nFull Name: IFN gamma\nCalculated Molecular Weight: 166 aa, 19 kDa\nObserved Molecular Weight: 20-25 kDa\nGenBank Accession Number: BC070256\nGene Symbol: IFNG\nGene ID (NCBI): 3458\nENSEMBL Gene ID: ENSG00000111537\nRRID: AB_3086082\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01579\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887676608681,"sku":"28722-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28722-1-ap","provider":"Iright","version":"1.0","type":"link"}