{"product_id":"proteintech-28724-1-ap","title":"Proteintech, 28724-1-AP, KCC2\/SLC12A5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KCC2\/SLC12A5 (28724-1-AP) by Proteintech is a Polyclonal antibody targeting KCC2\/SLC12A5 in WB, IHC, IF-P, ELISA applications with reactivity to Human, Mouse, Rat samples\n28724-1-AP targets KCC2\/SLC12A5 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKCC2, encoded by SLC12A5, is a neuron-specific K+-Cl- cotransporter that is essential for Cl- homeostasis and inhibitory synaptic transmission in brain. KCC2 is expressed at high levels in neurons throughout the nervous system. KCC2 deletion caused animal death. Alterations of KCC2 have been linked to neuropathic pain, temporal lobe epilepsy, and other diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30203 Product name: Recombinant human SLC12A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 915-1043 aa of BC132670 Sequence: ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKGPSPVSSEGIKDFFSMKPEWENLN Predict reactive species\nFull Name: solute carrier family 12 (potassium-chloride transporter), member 5\nObserved Molecular Weight: 130-150 kDa\nGenBank Accession Number: BC132670\nGene Symbol: KCC2\nGene ID (NCBI): 57468\nRRID: AB_2918195\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H2X9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869700051113,"sku":"28724-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28724-1-ap","provider":"Iright","version":"1.0","type":"link"}