{"product_id":"proteintech-28826-1-ap","title":"Proteintech, 28826-1-AP, PCOLCE Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCOLCE (28826-1-AP) by Proteintech is a Polyclonal antibody targeting PCOLCE in WB, ELISA applications with reactivity to Human samples\n28826-1-AP targets PCOLCE in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPCOLCE (Procollagen C-endopeptidase enhancer 1), also named as PCPE1, is a secreted glycoprotein that functions as a positive regulator of procollagen processing. The calculated molecular weight of PCOLCE is 48 kDa. PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity. Procollagen C-proteinases have important roles in developmental processes and assembly of the extracellular matrix. It has been reported that the dysregulation of PCOLCE is involved in numerous diseases. For instance, the expression of PCOLCE positively correlates with muscle and liver fibrosis (PMID: 27458976). And PCOLCE was highly expressed in osteosarcoma and may play an important role in promoting the lung metastasis of osteosarcoma (PMID: 31285765).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29719 Product name: Recombinant human PCOLCE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 269-431 aa of BC000574 Sequence: SYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVLPPESFVVLHRPNQDQILTN Predict reactive species\nFull Name: procollagen C-endopeptidase enhancer\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 48-50 kDa\nGenBank Accession Number: BC000574\nGene Symbol: PCOLCE\nGene ID (NCBI): 5118\nRRID: AB_3086087\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15113\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887753744553,"sku":"28826-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28826-1-ap","provider":"Iright","version":"1.0","type":"link"}