{"product_id":"proteintech-28838-1-ap","title":"Proteintech, 28838-1-AP, CD1c Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD1c (28838-1-AP) by Proteintech is a Polyclonal antibody targeting CD1c in IHC, ELISA applications with reactivity to human samples\n28838-1-AP targets CD1c in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD1c molecule (CD1c, also known as R7, CD1, CD1A, and BDCA1) is a member of the CD1 family of transmembrane glycoproteins, which is synthesized in the endoplasmic reticulum and expressed on the monocytes, marginal zone B cells in lymph nodes as well as peripheral blood (PMID: 23468110). The CD1 proteins belong to the family of major histocompatibility complex (MHC) class I-like proteins that present lipid-based antigens to T cells (PMID: 15032598; 23127489). CD1c shows interaction with both αβ or γδ T cells and mediates T cell responses against mycobacterium tuberculosis (PMID: 10727456; 10786796).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29830 Product name: Recombinant human CD1C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 18-118 aa of BC126467 Sequence: NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKA Predict reactive species\nFull Name: CD1c molecule\nCalculated Molecular Weight: 333 aa, 38 kDa\nGenBank Accession Number: BC126467\nGene Symbol: CD1C\nGene ID (NCBI): 911\nRRID: AB_3086090\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P29017\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886122717353,"sku":"28838-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28838-1-ap","provider":"Iright","version":"1.0","type":"link"}