{"product_id":"proteintech-28842-1-ap","title":"Proteintech, 28842-1-AP, POLR3A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe POLR3A (28842-1-AP) by Proteintech is a Polyclonal antibody targeting POLR3A in WB, IF\/ICC, ELISA applications with reactivity to human samples\n28842-1-AP targets POLR3A in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293 cells,  HeLa cells,  MCF-7 cells,  Y79 cells\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPOLR3A encodes the largest subunit of human RNA polymerase III (RPC1), which contributes to the catalytic activity of Pol III and is part of the active centre of the polymerase. Pol III is responsible for the transcription of untranslated RNAs (PMID: 25339210). Bi-allelic missense variants in POLR3A have been associated with phenotypes distinct from WRS: hypogonadotropic hypogonadism and hypomyelinating leukodystrophy with or without oligodontia (PMID: 30414627).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29036 Product name: Recombinant human POLR3A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-187 aa of BC041089 Sequence: MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNQHAPLLYGVLDHRMGTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQEEKKQFLDYLKRPGLTYLQKRGLKKKISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYKTNKKVVD Predict reactive species\nFull Name: polymerase (RNA) III (DNA directed) polypeptide A, 155kDa\nCalculated Molecular Weight: 1390 aa, 156 kDa\nObserved Molecular Weight: 155 kDa\nGenBank Accession Number: BC041089\nGene Symbol: POLR3A\nGene ID (NCBI): 11128\nRRID: AB_3669672\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14802\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887768162473,"sku":"28842-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28842-1-ap","provider":"Iright","version":"1.0","type":"link"}