{"product_id":"proteintech-28904-1-ap","title":"Proteintech, 28904-1-AP, SARS-CoV-2 Envelope Protein Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SARS-CoV-2 Envelope Protein (28904-1-AP) by Proteintech is a Polyclonal antibody targeting SARS-CoV-2 Envelope Protein in ELISA applications with reactivity to virus samples\n28904-1-AP targets SARS-CoV-2 Envelope Protein in WB, IF, ELISA applications and shows reactivity with virus samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive ELISA detected in: Recombinant protein\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nEnzyme-linked Immunosorbent Assay (ELISA): ELISA :\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEnvelope protein of coronaviruses is a structural protein existing in both monomeric and homopentameric form. It is a minor component of the virus membrane though it is deemed to be important for many stages including virus infection, replication, dissemination and immune response stimulation. Sequence comparison has shown that this protein is identical to the counterparts of specific Bat and Pangolin coronavirus isolates, even though the Sars-CoV-2 sequence seems to possess specific modifications and characteristics with respect to other Sars CoVs(PMID:32596311). The SARS-CoV-2 envelope protein provide a strategy to assess cross-protection against COVID-19 (PMID: 32446902).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: virus\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30690 Product name: Recombinant virus 2019-nCOV envelope protein protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-75 aa of NC_045512 Sequence: MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV Predict reactive species\nFull Name: COVID-19 E Protein\nGenBank Accession Number: NC_045512\nGene Symbol: SARS-CoV-2 Envelope Protein\nGene ID (NCBI): 43740570\nRRID: AB_2881232\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P0DTC4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869496561833,"sku":"28904-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28904-1-ap","provider":"Iright","version":"1.0","type":"link"}