{"product_id":"proteintech-28992-1-ap","title":"Proteintech, 28992-1-AP, TGFBR3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TGFBR3 (28992-1-AP) by Proteintech is a Polyclonal antibody targeting TGFBR3 in WB, ELISA applications with reactivity to human samples\n28992-1-AP targets TGFBR3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTransforming growth factor β (TGF-β) is a multifunctional cytokine that plays important roles in normal development and homeostasis (PMID: 8530052). There are three TGF-β forms: TGF-β1, TGF-β2, and TGF-β3. The diverse effects of TGF-β are mediated by the TGF-β receptors and cell surface-binding proteins. Three TGF-beta receptors exist: TGFBR1, TFGBR2, TGFBR3 (PMID: 8530052; 30184463). TGFBR3, also known as betaglycan, is a transmembrane proteoglycan that often functions as a co-receptor with other TGF-beta receptor superfamily members. In addition to the transmembrane form, the extracellular domain of TGFBR3 can be cleaved to a soluble form (sTGFBR3), which may serve as an antagonist of TGF-β to inhibit TGF-β signaling (PMID: 30184463). TGFBR3 has a larger apparent molecular weight than the calculated molecular weight, due to extensive carbohydrate modifications (PMID: 1556106).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29397 Product name: Recombinant human TGFBR3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 145-369 aa of BC136295 Sequence: TAETEERNFPHGNEHLLNWARKEYGAVTSFTELKIARNIYIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITPNSNPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNAEEMGDEEVHT Predict reactive species\nFull Name: transforming growth factor, beta receptor III\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC136295\nGene Symbol: TGFBR3\nGene ID (NCBI): 7049\nRRID: AB_3086094\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q03167\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868815610025,"sku":"28992-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28992-1-ap","provider":"Iright","version":"1.0","type":"link"}