{"product_id":"proteintech-29084-1-ap","title":"Proteintech, 29084-1-AP, G6PC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe G6PC (29084-1-AP) by Proteintech is a Polyclonal antibody targeting G6PC in WB, IF-P, ELISA applications with reactivity to human, mouse samples\n29084-1-AP targets G6PC in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, L02 cells\nPositive IF-P detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlucose-6-phosphatase-α (G6PC) is a key enzyme in glucose homeostasis that catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the terminal step of gluconeogenesis and glycogenolysis. G6PC activity is restricted to the liver , the kidney cortex and the small intestine and confers on these three organs the capacity to release glucose into the systemic circulation (PMID: 21983240).The encoded enzyme is anchored to the ER by nine transmembrane helices with the amino (N)-terminus in the lumen and the carboxyl (C)-terminus in the cytoplasm (PMID: 15542400).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30614 Product name: Recombinant human G6PC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-121 aa of BC130478 Sequence: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM Predict reactive species\nFull Name: glucose-6-phosphatase, catalytic subunit\nCalculated Molecular Weight: 357 aa, 40 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC130478\nGene Symbol: G6PC\nGene ID (NCBI): 2538\nRRID: AB_3669673\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35575\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868829438121,"sku":"29084-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29084-1-ap","provider":"Iright","version":"1.0","type":"link"}