{"product_id":"proteintech-29091-1-ap","title":"Proteintech, 29091-1-AP, HADHB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HADHB (29091-1-AP) by Proteintech is a Polyclonal antibody targeting HADHB in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n29091-1-AP targets HADHB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, MCF-7 cells,  mouse heart tissue,  mouse skeletal muscle tissue,  rat heart tissue,  rat liver tissue\nPositive IHC detected in: human stomach tissue, human  colon,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHADHB, also named as TP- beta, Acetyl-CoA acyltransferase and Beta-ketothiolase, is a mitochondrial trifunctional enzyme subunit beta. Mitochondrial trifunctional enzyme catalyzes the last three of the four reactions of the mitochondrial beta-oxidation pathway. The mitochondrial beta-oxidation pathway is the major energy-producing process in tissues and is performed through four consecutive reactions breaking down fatty acids into acetyl-CoA. Among the enzymes involved in this pathway, the trifunctional enzyme exhibits specificity for long-chain fatty acids. Mitochondrial trifunctional enzyme is a heterotetrameric complex composed of two proteins, the trifunctional enzyme subunit alpha\/HADHA carries the 2,3-enoyl-CoA hydratase and the 3-hydroxyacyl-CoA dehydrogenase activities, while the trifunctional enzyme subunit beta\/HADHB described here bears the 3-ketoacyl-CoA thiolase activity. HADHB has 2 isoforms produced by alternative splicing with the MW of 49 kDa and 51 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30298 Product name: Recombinant human HADHB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-262 aa of BC017564 Sequence: RAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLL Predict reactive species\nFull Name: hydroxyacyl-Coenzyme A dehydrogenase\/3-ketoacyl-Coenzyme A thiolase\/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC017564\nGene Symbol: HADHB\nGene ID (NCBI): 3032\nRRID: AB_2918233\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P55084\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868955431081,"sku":"29091-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29091-1-ap","provider":"Iright","version":"1.0","type":"link"}