{"product_id":"proteintech-29092-1-ap","title":"Proteintech, 29092-1-AP, RPL5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RPL5 (29092-1-AP) by Proteintech is a Polyclonal antibody targeting RPL5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, monkey samples\n29092-1-AP targets RPL5 in WB, IHC, IF\/ICC, RIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COS-7 cells, MOLT-4 cells,  NIH\/3T3 cells,  C6 cells,  PC-3 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe mammalian ribosome is a macromolecular assembly of 4 RNA species (rRNAs) and approximately 80 different proteins, including RPL5. RPL5 (ribosome protein L15) is rquired for rRNA maturation and formation of the 60S ribosomal subunits, and defects or mutation in RPL5 is the cause of DBA6.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, monkey\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30837 Product name: Recombinant human RPL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 178-297 aa of BC109370 Sequence: KRFPGYDSESKEFNAEVHRKHIMGQNVADYMRCLMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAES Predict reactive species\nFull Name: ribosomal protein L5\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC109370\nGene Symbol: RPL5\nGene ID (NCBI): 6125\nRRID: AB_2881240\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P46777\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868988199081,"sku":"29092-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29092-1-ap","provider":"Iright","version":"1.0","type":"link"}