{"product_id":"proteintech-29167-1-ap","title":"Proteintech, 29167-1-AP, TAK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAK1 (29167-1-AP) by Proteintech is a Polyclonal antibody targeting TAK1 in WB, IHC, ELISA applications with reactivity to human samples\n29167-1-AP targets TAK1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  K-562 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAP3K7(Mitogen-activated protein kinase kinase kinase 7) is also named as TAK1 and belongs to the MAP kinase kinase kinase subfamily. It plays an important role in the cascades of cellular responses evoked by changes in the environment. It has been linked to interleukin-1 receptor and tumor necrosis factor receptor signaling (PMID: 16186825). It has 4 isoforms (53-55 kDa, 64-70 kDa and 75-80 kDa) produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30725 Product name: Recombinant human MAP3K7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 404-579 aa of BC017715 Sequence: GNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS Predict reactive species\nFull Name: mitogen-activated protein kinase kinase kinase 7\nCalculated Molecular Weight: 579 aa, 64 kDa\nObserved Molecular Weight: 64-70 kDa\nGenBank Accession Number: BC017715\nGene Symbol: TAK1\nGene ID (NCBI): 6885\nRRID: AB_2918242\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43318\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887822622889,"sku":"29167-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29167-1-ap","provider":"Iright","version":"1.0","type":"link"}