{"product_id":"proteintech-29186-1-ap","title":"Proteintech, 29186-1-AP, Serotonin transporter Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Serotonin transporter (29186-1-AP) by Proteintech is a Polyclonal antibody targeting Serotonin transporter in WB, ELISA applications with reactivity to human, mouse samples\n29186-1-AP targets Serotonin transporter in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSerotonin transporter (SERT; SLC6A4) belongs to the sodium- and chloride-dependent monoamine transporter family. SERT is a membrane transporter that terminates the neurotransmission of serotonin, a monoaminergic neurotransmitter, through its reuptake. The SERT uptake mechanism acquires energy for active transport via ATP hydrolysis or via movement against electrochemical gradients. As an oligomeric N-glycan, SERT contains disulfide bonds between cysteine residues on the second extracellular domain. Post-translational modifications regulate the uptake kinetics and membrane trafficking of SERT, in part by regulating the proper folding and assembly of SERT in a host-dependent manner (PMID: 30394319).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30412 Product name: Recombinant human SLC6A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of NM_001045 Sequence: METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVD Predict reactive species\nFull Name: solute carrier family 6 (neurotransmitter transporter, serotonin), member 4\nCalculated Molecular Weight: 70 aa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_001045\nGene Symbol: Serotonin transporter\nGene ID (NCBI): 6532\nRRID: AB_2935471\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31645\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887796998313,"sku":"29186-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29186-1-ap","provider":"Iright","version":"1.0","type":"link"}