{"product_id":"proteintech-29214-1-ap","title":"Proteintech, 29214-1-AP, CDK17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDK17 (29214-1-AP) by Proteintech is a Polyclonal antibody targeting CDK17 in WB, ELISA applications with reactivity to Human, Mouse samples\n29214-1-AP targets CDK17 in WB, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells,  Jurkat cells,  U-251 cells,  mouse ovary tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclin-dependent kinase 17 (CDK17) belongs to the protein kinase superfamily. It may play a role in terminally differentiated neurons and has a Ser\/Thr-phosphorylating activity for histone H1. CDK17 can be detected as 60 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30200 Product name: Recombinant human CDK17 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-100 aa of NM_002595 Sequence: MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHEN Predict reactive species\nFull Name: PCTAIRE protein kinase 2\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: NM_002595\nGene Symbol: CDK17\nGene ID (NCBI): 5128\nRRID: AB_2935472\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q00537\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886395642025,"sku":"29214-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29214-1-ap","provider":"Iright","version":"1.0","type":"link"}