{"product_id":"proteintech-29252-1-ap","title":"Proteintech, 29252-1-AP, HDAC4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HDAC4 (29252-1-AP) by Proteintech is a Polyclonal antibody targeting HDAC4 in WB, IHC, ELISA applications with reactivity to Human samples\n29252-1-AP targets HDAC4 in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  Jurkat cells\nPositive IHC detected in: human ovary tumor tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHDAC4 (Histone deacetylase 4) belongs to class II of the histone deacetylase\/acuc\/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. Histone deacetylation gives a tag for epigenetic repression and plays a role in transcriptional regulation, cell cycle progression and developmental events. It is involved in muscle maturation by its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D. HDAC4 is required for TGFbeta1-induced myofibroblastic differentiation (PMID: 17610967). HDAC4 encoded by an allele associated with mental retardation is a gain-of-function nuclear repressor that abolishes transcription and synaptic transmission (PMID: 23141539).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30752 Product name: Recombinant human HDAC4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 888-972 aa of BC039904 Sequence: LPEKVLQQRPNANAVRSMEKVMEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL Predict reactive species\nFull Name: histone deacetylase 4\nCalculated Molecular Weight: 972 aa, 106 kDa\nObserved Molecular Weight: 120-140 kDa\nGenBank Accession Number: BC039904\nGene Symbol: HDAC4\nGene ID (NCBI): 9759\nRRID: AB_3086107\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56524\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887664582825,"sku":"29252-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29252-1-ap","provider":"Iright","version":"1.0","type":"link"}