{"product_id":"proteintech-29265-1-ap","title":"Proteintech, 29265-1-AP, MEKK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MEKK2 (29265-1-AP) by Proteintech is a Polyclonal antibody targeting MEKK2 in WB, IHC, ELISA applications with reactivity to human samples\n29265-1-AP targets MEKK2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  MCF-7 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAP3K2, also named as MEKK2 and MEKK2B, belongs to the protein kinase superfamily, STE Ser\/Thr protein kinase family and MAPK kinase kinase subfamily. It is a component of a protein kinase signal transduction cascade. MAP3K2 mediates activation of the NF-kappa-B, AP1 and DDIT3 transcriptional regulators. The antibody is specific to MAP3K2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30886 Product name: Recombinant human MAP3K2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of NM_006609 Sequence: MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSR Predict reactive species\nFull Name: mitogen-activated protein kinase kinase kinase 2\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_006609\nGene Symbol: MAP3K2\nGene ID (NCBI): 10746\nRRID: AB_2918263\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2U5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869709029545,"sku":"29265-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29265-1-ap","provider":"Iright","version":"1.0","type":"link"}