{"product_id":"proteintech-29272-1-ap","title":"Proteintech, 29272-1-AP, GAB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GAB2 (29272-1-AP) by Proteintech is a Polyclonal antibody targeting GAB2 in WB, IHC, ELISA applications with reactivity to Human samples\n29272-1-AP targets GAB2 in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\nPositive IHC detected in: human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGrowth factor receptor-bound protein 2 (GAB2), an adaptor protein, belongs to the Gab family and is involved in various biologic processes. Gab2 mainly mediates phosphatidylinositol 3-kinase (PI3K) and extracellular signal-regulated kinase (ERK) signaling pathways. Furthermore, Gab2 governs tumorigenic signaling and is a novel potential therapeutic target in leukemia, breast cancer, ovarian cancer, and melanoma. Gab2 is the major 98-kDa phosphoprotein associated with SHP-2, PI 3-kinase, and Grb2 in normal human lymphocytes. (PMID: 32269703, PMID: 28842424, PMID: 28420432, PMID: 10849428)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30347 Product name: Recombinant human GAB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 588-676 aa of BC131711 Sequence: QNPVSASPVPSGTNSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQEWTDVRQSSEPSKGAKL Predict reactive species\nFull Name: GRB2-associated binding protein 2\nCalculated Molecular Weight: 676 aa, 74 kDa\nObserved Molecular Weight: 74-90 kDa\nGenBank Accession Number: BC131711\nGene Symbol: GAB2\nGene ID (NCBI): 9846\nRRID: AB_2918265\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UQC2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887645249705,"sku":"29272-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29272-1-ap","provider":"Iright","version":"1.0","type":"link"}