{"product_id":"proteintech-29283-1-ap","title":"Proteintech, 29283-1-AP, TPH2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TPH2 (29283-1-AP) by Proteintech is a Polyclonal antibody targeting TPH2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n29283-1-AP targets TPH2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, mouse brain tissue\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTPH2 protein is a key enzyme in the synthesis of serotonin in the brain. It is mainly expressed in the brain and is responsible for converting tryptophan to 5-hydroxytryptophan, a precursor of serotonin. TPH2 plays a crucial role in regulating mood, anxiety, and stress responses. Variations in the TPH2 gene have been associated with several psychiatric disorders, including depression and bipolar disorder. Additionally, TPH2 expression can be regulated by various factors, such as hormones and environmental stimuli (PMID: 22241550, PMID: 29775696, PMID: 32119710, PMID: 40204433).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30281 Product name: Recombinant human TPH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 440-496 aa of BC114442 Sequence: DFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLGI Predict reactive species\nFull Name: tryptophan hydroxylase 2\nCalculated Molecular Weight: 490 aa, 56 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC114442\nGene Symbol: TPH2\nGene ID (NCBI): 121278\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IWU9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887835959465,"sku":"29283-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29283-1-ap","provider":"Iright","version":"1.0","type":"link"}