{"product_id":"proteintech-29290-1-ap","title":"Proteintech, 29290-1-AP, NADK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NADK (29290-1-AP) by Proteintech is a Polyclonal antibody targeting NADK in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n29290-1-AP targets NADK in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Hela cells,  Neuro-2a cells,  NIH\/3T3 cells,  rat kidney tissue\nPositive IHC detected in: human ovary cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNAD kinase (NADK) is the sole NADP+-biosynthetic enzyme that catalyzes phosphorylation of NAD+ to yield NADP+ using ATP as a phosphoryl donor, and thus, plays a vital role in the cell and represents a potentially powerful antimicrobial drug target (PMID:21526340). It belongs to the NAD kinase family. NADK has 3 isoforms with the molecular mass of 49, 63 and 46 kDa. The catalytically active human NADK is a homotetramer (PMID:11594753).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30982 Product name: Recombinant human NADK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-446 aa of BC001709 Sequence: SRLKVRVVKELRGKKTAVHNGLGEKGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFESLAQCLHWNVRKKQAHFEEEEEEEEEG Predict reactive species\nFull Name: NAD kinase\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC001709\nGene Symbol: NADK\nGene ID (NCBI): 65220\nRRID: AB_2918272\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95544\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887731724457,"sku":"29290-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29290-1-ap","provider":"Iright","version":"1.0","type":"link"}