{"product_id":"proteintech-29293-1-ap","title":"Proteintech, 29293-1-AP, BRWD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BRWD1 (29293-1-AP) by Proteintech is a Polyclonal antibody targeting BRWD1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n29293-1-AP targets BRWD1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, MCF-7 cells,  NIH\/3T3 cells\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBRWD1 (Bromodomain and WD repeat domain containing 1, also known as WDR9) has a predicted molecular weight of 263 kDa and contains tandem BROMO domains and WD40 repeats (PMID:12889071). One of the remarkable functions of BRWD1 was the coordinated repression of MYC and MYC target genes. At the Myc\/MYC locus, in both mice and humans, BRWD1 specififically repressed distal enhancers, which are associated with lineage specifific expression (PMID:30250168). In addition,BRWD1 as a key epigenomic mediator of normal neurodevelopment and an important contributor to DS (Down syndrome)-related phenotypes (PMID:36289231).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30902 Product name: Recombinant human BRWD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC064602 Sequence: MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI Predict reactive species\nFull Name: bromodomain and WD repeat domain containing 1\nCalculated Molecular Weight: 2320 aa, 263 kDa\nObserved Molecular Weight: 263 kDa\nGenBank Accession Number: BC064602\nGene Symbol: BRWD1\nGene ID (NCBI): 54014\nRRID: AB_3086110\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NSI6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885284741289,"sku":"29293-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29293-1-ap","provider":"Iright","version":"1.0","type":"link"}