{"product_id":"proteintech-29309-1-ap","title":"Proteintech, 29309-1-AP, GDF9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GDF9 (29309-1-AP) by Proteintech is a Polyclonal antibody targeting GDF9 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n29309-1-AP targets GDF9 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, A2780 cells,  SKOV-3 cells,  mouse ovary tissue,  rat ovary tissue,  mouse brain tissue,  mouse testis tissue,  rat brain tissue,  rat testis tissue\nPositive IHC detected in: mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SKOV-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGDF9 (Growth\/differentiation factor 9) belongs to the TGF-beta family. GDF9 is required for ovarian folliculogenesis. GDF9 and BMP15 are oocyte-secreted factors with a leading role in the control of ovarian function in female reproduction, modulating both the cell fate of the somatic granulosa cells and the quality and developmental competence of the egg (PMID: 29544636). GDF9 promotes cell transition from G0\/G1 to S and G2\/M phases, through an increase of CCND1 and CCNE1 expression, and RB1 phosphorylation (PMID: 19366876). It regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. GDF9 attenuates the suppressive effects of activin A on STAR expression and progesterone production by increasing the expression of inhibin B (PMID: 21829661). It suppresses FST and FSTL3 production in granulosa-lutein cells  (PMID: 21632818, PMID: 21829661).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29603 Product name: Recombinant human GDF9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 400-454 aa of BC096228 Sequence: TMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR Predict reactive species\nFull Name: growth differentiation factor 9\nCalculated Molecular Weight: 454 aa, 51 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC096228\nGene Symbol: GDF9\nGene ID (NCBI): 2661\nRRID: AB_3086112\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60383\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869462876329,"sku":"29309-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29309-1-ap","provider":"Iright","version":"1.0","type":"link"}