{"product_id":"proteintech-29312-1-ap","title":"Proteintech, 29312-1-AP, Parvalbumin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Parvalbumin (29312-1-AP) by Proteintech is a Polyclonal antibody targeting Parvalbumin in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n29312-1-AP targets Parvalbumin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse skeletal muscle tissue,  rat brain tissue,  rat skeletal muscle tissue\nPositive IHC detected in: mouse cerebellum tissue, mouse brain tissue,  rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse cerebellum tissue, mouse brain tissue,  rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPVALB is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. PVALB is expressed in high levels only in fast-contracting muscles and at lower levels in brain and several endocrine tissues. It is thought to be involved in muscle relaxation. Monomeric (12 kDa) and dimeric (24 kDa) forms, as well as trimeric Parvalbumin (38 kDa), have been described in a literature (PMID: 19616851).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30189 Product name: Recombinant human PVALB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-110 aa of NM_002854 Sequence: SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES Predict reactive species\nFull Name: parvalbumin\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: NM_002854\nGene Symbol: Parvalbumin\nGene ID (NCBI): 5816\nRRID: AB_2918280\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20472\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868971552937,"sku":"29312-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29312-1-ap","provider":"Iright","version":"1.0","type":"link"}