{"product_id":"proteintech-29313-1-ap","title":"Proteintech, 29313-1-AP, C22orf32 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C22orf32 (29313-1-AP) by Proteintech is a Polyclonal antibody targeting C22orf32 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n29313-1-AP targets C22orf32 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SW480 cells\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC22orf32, also known as SMDT1 or EMRE, is a 10 kDa single-channel transmembrane that contains a mitochondrial targeting sequence, a transmembrane region, and a conserved aspart-rich C-terminal. It acts as a subunit of the MCU complex and increases mCa2+ uptake by activating the MCU function (PMID: 38417574).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29162 Product name: Recombinant human C22orf32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC024237 Sequence: MASGAARWLVLAPVRSGALRSGPSLRKDGDVSAAWSGSGRSLVPSGSVIVTRSGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD Predict reactive species\nFull Name: chromosome 22 open reading frame 32\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC024237\nGene Symbol: C22orf32\nGene ID (NCBI): 91689\nRRID: AB_3669681\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H4I9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885572739241,"sku":"29313-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29313-1-ap","provider":"Iright","version":"1.0","type":"link"}