{"product_id":"proteintech-29316-1-ap","title":"Proteintech, 29316-1-AP, CDCA5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDCA5 (29316-1-AP) by Proteintech is a Polyclonal antibody targeting CDCA5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n29316-1-AP targets CDCA5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  LNCaP cells,  U2OS cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:600-1:2400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman cell division cycle associated 5 (CDCA5), also known as Sororin, is required for stable binding of cohesin to chromatid in the S and G2\/M phases and degraded through anaphase-promoting complex-dependent ubiquitination in the G0\/G1 phase (PMID: 30808873). Suppression of CDCA5 expression with siRNAs inhibited the growth of lung cancer cells. CDCA5 positivity is an independent prognostic factor for lung cancer patients (PMID: 20551060). The predicted molecular size of CDCA is 27 kd, with an electrophoretic mobility of ~35 kd on SDS-PAGE, possibly due to its isoelectric point (pI) of approximately 10 (PMID: 22580470).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30966 Product name: Recombinant human CDCA5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 120-252 aa of BC011000 Sequence: PEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE Predict reactive species\nFull Name: cell division cycle associated 5\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 27~35 kDa\nGenBank Accession Number: BC011000\nGene Symbol: CDCA5\nGene ID (NCBI): 113130\nRRID: AB_3086115\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96FF9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886390005929,"sku":"29316-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29316-1-ap","provider":"Iright","version":"1.0","type":"link"}