{"product_id":"proteintech-29361-1-ap","title":"Proteintech, 29361-1-AP, CD134\/OX40 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD134\/OX40 (29361-1-AP) by Proteintech is a Polyclonal antibody targeting CD134\/OX40 in WB, ELISA applications with reactivity to Human samples\n29361-1-AP targets CD134\/OX40 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MJ cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD134, also known as OX40 and TNFRSF4, is a member of the TNFR-superfamily of receptors (PMID: 2828930; 9766631). It is a type I transmembrane protein predominantly expressed on activated T cells which include CD4 and CD8 T cells, Th2, Th1, and Th17 cells, as well as regulatory T cells (Tregs) (PMID: 20307208). CD134 is activated by its cognate ligand CD134L (OX40L) and functions as a T cell co-stimulatory molecule (PMID: 26215166). CD134-CD134L interactions have been proposed as a potential therapeutic target for treating autoimmune diseases, cancer and infectious disease (PMID: 26215166; 19426222).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28521 Product name: Recombinant human TNFRSF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-214 aa of NM_003327 Sequence: MLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRA Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 4\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: NM_003327\nGene Symbol: CD134\nGene ID (NCBI): 7293\nRRID: AB_3669684\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P43489\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886072484009,"sku":"29361-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29361-1-ap","provider":"Iright","version":"1.0","type":"link"}