{"product_id":"proteintech-29365-1-ap","title":"Proteintech, 29365-1-AP, PPP2R5A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPP2R5A (29365-1-AP) by Proteintech is a Polyclonal antibody targeting PPP2R5A in WB, ELISA applications with reactivity to Human, Mouse, Rat samples\n29365-1-AP targets PPP2R5A in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse heart tissue,  rat heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein phosphatase 2, regulatory subunit B (B56), alpha isoform (PPP2R5A) is one of the regulatory subunits of the protein phosphatase 2A (PP2A), which is a major member of protein serine\/threonine phosphatases in cells. PPP2R5A can regulate the cellular location, substrate specification and protein phosphatase function of PP2A, through which PPP2R5A plays an important role in many cellular activities. It has been reported that PPP2R5A relates with many diseases including cancers by regulating many crucial signaling pathways involved in P53, Bcl-2, CDK, MAPK, JAK\/STAT, c-Myc and β-Catenin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31072 Product name: Recombinant human PPP2R5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 48-129 aa of BC022474 Sequence: GSQAELHPLPQLKDATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAYSDIVKMISA Predict reactive species\nFull Name: protein phosphatase 2, regulatory subunit B', alpha isoform\nCalculated Molecular Weight: 486 aa, 56 kDa\nObserved Molecular Weight: 50-56 kDa\nGenBank Accession Number: BC022474\nGene Symbol: PPP2R5A\nGene ID (NCBI): 5525\nRRID: AB_3086125\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15172\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887770980521,"sku":"29365-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29365-1-ap","provider":"Iright","version":"1.0","type":"link"}