{"product_id":"proteintech-29387-1-ap","title":"Proteintech, 29387-1-AP, VPS13D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VPS13D (29387-1-AP) by Proteintech is a Polyclonal antibody targeting VPS13D in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n29387-1-AP targets VPS13D in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVPS13 (vacuolar protein sorting 13 ) acts at membrane contact sites between intracellular organelles to transport lipids.  There are four VPS13 family members in human - VPS13A, VPS13B, VPS13C and VPS13D. Mutations in human VPS13 genes are linked to rare neurodegenerative disorders: chorea- acanthocytosis (VPS13A), Cohen syndrome (VPS13B), predispose to early onset into Parkinson disease (VPS13C) and lead to ataxia\/spastic paraplegia (VPS13D) (PMID: 30656912).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29933 Product name: Recombinant human VPS13D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4202-4388 aa of NM_015378 Sequence: DFASETAQAVRDTATLSGPRTQAQRVRKPRCCTGPQGLLPRYSESQAEGQEQLFKLTDNIQDEFFIAVENIDSYCVLISSKAVYFLKSGDYVDREAIFLEVKYDDLYHCLVSKDHGKVYVQVTKKAVSTSSGVSIPGPSHQKPMVHVKSEVLAVKLSQEINYAKSLYYEQQLMLRLSENREQLELDS Predict reactive species\nFull Name: vacuolar protein sorting 13 homolog D (S. cerevisiae)\nCalculated Molecular Weight: 492 kDa\nObserved Molecular Weight: ~500 kDa\nGenBank Accession Number: NM_015378\nGene Symbol: VPS13D\nGene ID (NCBI): 55187\nRRID: AB_3086126\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5THJ4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887920468137,"sku":"29387-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29387-1-ap","provider":"Iright","version":"1.0","type":"link"}