{"product_id":"proteintech-29388-1-ap","title":"Proteintech, 29388-1-AP, CEBP Alpha\/CEBPA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEBP Alpha\/CEBPA (29388-1-AP) by Proteintech is a Polyclonal antibody targeting CEBP Alpha\/CEBPA in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n29388-1-AP targets CEBP Alpha\/CEBPA in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BGC-823 cells, LNCaP cells,  THP-1 cells,  U-937 cells,  K-562 cells,  L02 cells,  HL-60 cells\nPositive IP detected in: THP-1 cells\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCEBPA and its isoforms play important roles in lineage determination and gene activation in a variety of cell types by activating transcription from lineage-specific promoters. CEBPA is a DNA-binding protein that recognizes two different motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. In hematopoiesis, C\/EBPa is a key factor in driving the development of myeloid cells interacting with a variety of factors, including c-Myc, PU.1, and microRNAs. It can also form heterodimers with the related proteins CEBP-beta and CEBP-gamma. The encoded protein has been shown to bind to the promoter and modulate the expression of the gene encoding leptin which plays an important role in body weight homeostasis. CEBPA can interact with CDK2 and CDK4, thereby inhibiting these kinases and causing growth arrest in cultured cells. Several pathways have been implicated as the means by which CEBPA mediates cell cycle arrest and proliferation, including p21, cyclin-dependent kinases and the E2F complex via c-Myc. The calcualted molecular weight of CEBPA is 38 kDa, but modified CEBPA is about 42 kDa (PMID: 19623175).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29947 Product name: Recombinant human CEBPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-125 aa of NM_004364 Sequence: MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAH Predict reactive species\nFull Name: CCAAT\/enhancer binding protein (C\/EBP), alpha\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: NM_004364\nGene Symbol: CEBPA\nGene ID (NCBI): 1050\nRRID: AB_3086127\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49715\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868881277097,"sku":"29388-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29388-1-ap","provider":"Iright","version":"1.0","type":"link"}