{"product_id":"proteintech-29424-1-ap","title":"Proteintech, 29424-1-AP, PPP1R3C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPP1R3C (29424-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R3C in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n29424-1-AP targets PPP1R3C in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, mouse cerebellum tissue,  rat cerebellum tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\n•\tProtein phosphatase 1 regulatory subunit 3C (PPP1R3C) is an enzyme that binds to protein phosphatase-1 (PP1) as a regulator. The central role of PPP1R3C is associated with glycogenesis and the overexpression of this gene increases glycogen storage. The cellular glycogen level is suppressed when PPP1R3C is knocked-down. PPP1R3C induces glycogen accumulation via HIF1 α during hypoxia and it is hypermethylated in melanoma (PMID: 25846879). Overexpression of PPP1R3C increased hepatic gluconeogenesis in vitro and in vivo while knockdown of PPP1R3C showed an opposite result (PMID: 31181215).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30280 Product name: Recombinant human PPP1R3C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-185 aa of BC012625 Sequence: PYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLNDISSALKHHEEKNLILDFPQPSTDYLSFRSHFQKNFVCLENCSLQERTVTGTVKVKNVSFEKKVQ Predict reactive species\nFull Name: protein phosphatase 1, regulatory (inhibitor) subunit 3C\nCalculated Molecular Weight: 317 aa, 36 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC012625\nGene Symbol: PPP1R3C\nGene ID (NCBI): 5507\nRRID: AB_2918304\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UQK1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869735211177,"sku":"29424-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29424-1-ap","provider":"Iright","version":"1.0","type":"link"}