{"product_id":"proteintech-29510-1-ap","title":"Proteintech, 29510-1-AP, RASGRP4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RASGRP4 (29510-1-AP) by Proteintech is a Polyclonal antibody targeting RASGRP4 in WB, ELISA applications with reactivity to human samples\n29510-1-AP targets RASGRP4 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, K-562 cells,  Raji cells,  Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRASGRP4 is a member of the RAS guanine nucleotide-releasing protein (RASGRP) family, which are crucial guanine nucleotide exchange factors (GEFs). The primary function of this family is to act as molecular switches that activate RAS signaling pathways by promoting the exchange of GDP for GTP on small GTPases. Specifically, RASGRP4 is highly and preferentially expressed in mast cells. It plays a vital role in the development, maturation, and functional activation of these immune cells by regulating key signaling cascades, such as the MAPK pathway.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31219 Product name: Recombinant human RASGRP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 108-170 aa of BC146669 Sequence: KATGDTQELRRLQICHLVRYWLMRHPEVMHQDPQLEEVIGRFWATVAREGNSAQRRLGDSSDL Predict reactive species\nFull Name: RAS guanyl releasing protein 4\nCalculated Molecular Weight: 673 aa, 75 kDa\nObserved Molecular Weight: 54-75 kDa\nGenBank Accession Number: BC146669\nGene Symbol: RASGRP4\nGene ID (NCBI): 115727\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TDF6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887779729577,"sku":"29510-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29510-1-ap","provider":"Iright","version":"1.0","type":"link"}