{"product_id":"proteintech-29516-1-ap","title":"Proteintech, 29516-1-AP, PHF8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PHF8 (29516-1-AP) by Proteintech is a Polyclonal antibody targeting PHF8 in WB, IHC, ELISA applications with reactivity to Human samples\n29516-1-AP targets PHF8 in WB, IHC, IF, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HeLa cells,  Jurkat cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPlant homeodomain finger protein 8 (PHF8) is a JmjC domain-containing protein. PHF8 is localized in the nucleolus and may regulate rRNA transcription. As a member of  the KDM7 subfamily of enzymes, PHF8 is involved in demethylation of lysine residues in histones such as H3K27me2\/1, H3K9me2\/1 and H4K20me1. PHF8 has been reported to participate in cancer development and metastasis of various types of tumors(PMID: 33111613). PHF8 has 5 isoforms produced by alternative splicing(Uniprot).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30701 Product name: Recombinant human PHF8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 786-948 aa of NM_001184896 Sequence: GQDRSSGSSSSGLGTVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDSLGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGTRVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLLKEVEQPRPQDSN Predict reactive species\nFull Name: PHD finger protein 8\nCalculated Molecular Weight: 118 kDa\nObserved Molecular Weight: 125-135 kDa\nGenBank Accession Number: NM_001184896\nGene Symbol: PHF8\nGene ID (NCBI): 23133\nRRID: AB_2935473\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UPP1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869728264361,"sku":"29516-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29516-1-ap","provider":"Iright","version":"1.0","type":"link"}