{"product_id":"proteintech-29624-1-ap","title":"Proteintech, 29624-1-AP, SRGAP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SRGAP3 (29624-1-AP) by Proteintech is a Polyclonal antibody targeting SRGAP3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n29624-1-AP targets SRGAP3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSRGAP3 (SLIT-ROBO Rho GTPase Activating Protein 3), also named MEGAP and WRP, is a member of the Slit-Robo sub-family of Rho GTPase-activating proteins (Rho GAPs), controls actin and microtubule dynamics through negative regulation of Rac(PMID: 23108406). Diseases associated with SRGAP3 include Pilomyxoid Astrocytoma and Avoidant Personality Disorder. SRGAP3 is highly expressed in fetal and adult brain, including the cortex and the hippocampus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31196 Product name: Recombinant human SRGAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 823-947 aa of NM_014850 Sequence: PLLDDKASSKNDLQSPTEHISDYGFGGVMGRVRLRSDGAAIPRRRSGGDTHSPPRGLGPSIDTPPRAAACPSSPHKIPLTRGRIESPEKRRMATFGSAGSINYPDKKALSEGHSMRSTCGSTRHS Predict reactive species\nFull Name: SLIT-ROBO Rho GTPase activating protein 3\nCalculated Molecular Weight: 124 kDa\nObserved Molecular Weight: 125 kDa\nGenBank Accession Number: NM_014850\nGene Symbol: SRGAP3\nGene ID (NCBI): 9901\nRRID: AB_2918334\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43295\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887816462505,"sku":"29624-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29624-1-ap","provider":"Iright","version":"1.0","type":"link"}