{"product_id":"proteintech-29663-1-ap","title":"Proteintech, 29663-1-AP, MADD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MADD (29663-1-AP) by Proteintech is a Polyclonal antibody targeting MADD in WB, IHC, ELISA applications with reactivity to human samples\n29663-1-AP targets MADD in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, HeLa cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMADD, MAP kinase-activating death domain protein, belongs to the DENN family, which regulates the Rab family is small GTPases (PMID: 20937701, PMID: 18559336). MADD plays a role in synaptic vesicle formation and in vesicle trafficking at the neuromuscular junction. MADD is also involved in TNFA-mediated activation of the MAPK pathway, including ERK1\/2 (PMID: 32761064). KIF1Bβ- and KIF1A-mediated axonal transport of presynaptic regulator Rab3 occurs in a GTP-dependent manner through MADD (PMID: 18849981).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31292 Product name: Recombinant human MADD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1395-1544 aa of BC040484 Sequence: WRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICYSVLCLFSYVAAVHSSEEDLRTPPRPVSS Predict reactive species\nFull Name: MAP-kinase activating death domain\nCalculated Molecular Weight: 1544 aa, 171 kDa\nObserved Molecular Weight: 200-250 kDa\nGenBank Accession Number: BC040484\nGene Symbol: MADD\nGene ID (NCBI): 8567\nRRID: AB_3086151\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WXG6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887710687401,"sku":"29663-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29663-1-ap","provider":"Iright","version":"1.0","type":"link"}