{"product_id":"proteintech-29685-1-ap","title":"Proteintech, 29685-1-AP, HTR3A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HTR3A (29685-1-AP) by Proteintech is a Polyclonal antibody targeting HTR3A in WB, ELISA applications with reactivity to human, mouse samples\n29685-1-AP targets HTR3A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHTR3A (5-hydroxytryptamine receptor 3A, 5-HT3A) belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (5-HT, serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. So far, five distinct 5-HT3 receptor subunits (A-E) have been identified. HTR3A can form functional homomers or heteromers with HTR3B or HTR3C or HTR3D or HTR3E. 5-HT3 receptors are capable of mediating fast excitatory neurotransmission in the CNS and peripheral nervous system (PNS). (PMID: 23038271; 17073663)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31317 Product name: Recombinant human HTR3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-132 aa of BC002354 Sequence: RRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGKSP Predict reactive species\nFull Name: 5-hydroxytryptamine (serotonin) receptor 3A\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC002354\nGene Symbol: HTR3A\nGene ID (NCBI): 3359\nRRID: AB_2918338\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P46098\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869549482153,"sku":"29685-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29685-1-ap","provider":"Iright","version":"1.0","type":"link"}