{"product_id":"proteintech-29751-1-ap","title":"Proteintech, 29751-1-AP, STUB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STUB1 (29751-1-AP) by Proteintech is a Polyclonal antibody targeting STUB1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n29751-1-AP targets STUB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HEK-293 cells,  NIH\/3T3 cells,  PC-12 cells,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: rat lung tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTUB1, also named as CHIP, SDCCAG7, UBOX1 and NY-CO-7, is a E3 ubiquitin-protein ligase which targets misfolded chaperone substrates towards proteasomal degradation. STUB1\/CHIP modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. It mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation. STUB1\/CHIP mediates polyubiquitination of CYP3A4.(PMID:10330192) CHIP\/STUB1 strongly reduced keratin aggregates through increased degradation of mutant K14. (PMID:20151404) STUB1\/CHIP regulates NAD(P)H:quinone oxidoreductase 1 (NQO1) accumulation in aged brain, a process impaired in certain Alzheimer patients.(PMID:21220432 )\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31335 Product name: Recombinant human STUB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 73-303 aa of BC007545 Sequence: MQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY Predict reactive species\nFull Name: STIP1 homology and U-box containing protein 1\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC007545\nGene Symbol: STUB1\nGene ID (NCBI): 10273\nRRID: AB_2923603\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UNE7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887818723497,"sku":"29751-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29751-1-ap","provider":"Iright","version":"1.0","type":"link"}