{"product_id":"proteintech-29762-1-ap","title":"Proteintech, 29762-1-AP, KCNK12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KCNK12 (29762-1-AP) by Proteintech is a Polyclonal antibody targeting KCNK12 in WB, ELISA applications with reactivity to Human, mouse samples\n29762-1-AP targets KCNK12 in WB, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPotassium channel, subfamily K, member 12, also known as KCNK12,  is a potassium channel containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. The calculated MW is 49 kDa, 29762-1-AP can detect a band around 49 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31561 Product name: Recombinant human KCNK12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 302-430 aa of NM_022055 Sequence: IKQVLNWMLRKLSCRCCARCCPAPGAPLARRNAITPGSRLRRRLAALGADPAARDSDAEGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGFSGGVGALGIMNNRLAETSASR Predict reactive species\nFull Name: potassium channel, subfamily K, member 12\nCalculated Molecular Weight: 47KD\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: NM_022055\nGene Symbol: KCNK12\nGene ID (NCBI): 56660\nRRID: AB_3086156\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HB15\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887691583657,"sku":"29762-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29762-1-ap","provider":"Iright","version":"1.0","type":"link"}